{{ isErrorSetToBasket === false ? 'Товар добавлен вкорзину' : 'Не удалось добавить товар в корзину'}}
Перейти в корзину
{{Object.keys(error)[0]}}:
{{Object.values(error)[0]}}
Цена По запросу
Количество
Вы уже добавили максимально доступное на складе кол-во товара
Достигнуто максимально доступное кол-во
Под заказ
{{!!storageProduct ? 'На складе' : 'Под заказ'}}
Ожидается поставка
Description_x000D_
General description_x000D_
C3ORF31 (TAMM41 or TAM41) codes for a mitochondrial translocator assembly and maintenance protein._x000D_
Rabbit Anti-C3ORF31 antibody recognizes bovine and human C3ORF31._x000D_
Immunogen_x000D_
Synthetic peptide directed towards the N terminal region of human C3orf31_x000D_
Application_x000D_
Rabbit Anti-C3ORF31 antibody is suitable for western blot applications at a concentration of 2.5μg/ml and for IHC using paraffin-embedded tissue at 4-8μg/ml._x000D_
Physical form_x000D_
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_
Disclaimer_x000D_
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_
Biochem/physiol Actions_x000D_
C3orf31 may be involved in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane._x000D_
Sequence_x000D_
Synthetic peptide located within the following region: QSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVD
- Related Categories Alphabetical Index, Antibodies, C2-C9, Primary Antibodies conjugate